Sean D'Souza — Email Marketing Analysis

Strategy, Copywriting, and the Psychotactics System

📅 17 March 2026 🇬🇧 English analysiscopywritingemail-marketingenglish
📋 Table of Contents (19 sections)
  1. 1. The Master Strategy Overview
  2. 2. The Sending Cadence System
  3. 3. The Two-Email-Type Model
  4. 4. Subject Line Formulas
  5. 5. The Article Email Blueprint
  6. 6. The Hook Architecture
  7. 7. Story-First Copywriting System
  8. 8. The Promotional Email System
  9. 9. The Product Launch Cadence
  10. 10. The Perpetual Sales Engine
  11. 11. Content Recycling Strategy
  12. 12. The P.S. Strategy
  13. 13. Multi-Platform Distribution
  14. 14. Recurring Content Themes
  15. 15. Relationship Building Patterns
  16. 16. The Copywriting Language Patterns
  17. 17. The Business Model Behind the Emails
  18. 18. Copywriting Templates You Can Steal
  19. Summary: The 10 Principles Behind Sean D’Souza’s Email System
  1. The Master Strategy Overview
  2. The Sending Cadence System
  3. The Two-Email-Type Model
  4. Subject Line Formulas
  5. The Article Email Blueprint
  6. The Hook Architecture
  7. Story-First Copywriting System
  8. The Promotional Email System
  9. The Product Launch Cadence
  10. The Perpetual Sales Engine
  11. Content Recycling Strategy
  12. The P.S. Strategy
  13. Multi-Platform Distribution
  14. Recurring Content Themes
  15. Relationship Building Patterns
  16. The Copywriting Language Patterns
  17. The Business Model Behind the Emails
  18. Copywriting Templates You Can Steal

1. The Master Strategy Overview

Sean D’Souza has been sending emails to his list since at least 2015. Over 11 years, 1,173 emails have landed in this subscriber’s inbox — averaging roughly 2 emails per week, every single week, without fail.

This is not spray-and-pray email marketing. It is a precisely engineered system built on a small number of repeating principles:

The core strategy in one paragraph: Send a valuable article on Saturday, send a second article (or the same one with a promotional angle) on Tuesday, and every 6–8 weeks rotate in a 2-email sales sequence for one of your 8–10 evergreen products. Keep this up for a decade. Never stop.

The numbers behind this:

MetricValue
Total emails sent (2015–2026)1,173
Average per year~107
Average per week~2.0
Article/content emails642 (54.7%)
Promotional emails484 (41.3%)
Event announcements33 (2.8%)
Podcast highlights8 (0.7%)
Roundup emails6 (0.5%)

What makes this remarkable is the consistency. There is no year where volume drops significantly. There is no “summer slowdown” or “holiday break.” The machine runs every week, every year.


2. The Sending Cadence System

The Tuesday/Saturday Rule

Out of 1,173 emails analysed, 94.3% were sent on exactly two days:

DayCount%
Tuesday56348.0%
Saturday54446.4%
All other days665.6%

This is not accidental. Sean has been asked about this and openly discusses the Tuesday/Saturday pattern as a deliberate choice. Saturday emails serve the “weekend learner” — someone with time to read. Tuesday emails reach the “professional” mid-week mindset.

Send Time Analysis

Tuesdays: Emails predominantly arrive at 19:00–20:00 UTC (7–8pm New Zealand / 8–9am US Eastern). Saturdays: Emails predominantly arrive at 10:00–13:00 UTC (10am–1pm New Zealand / 3–6am US Eastern).

The send time is calibrated to New Zealand (where Sean lives), but arrives at reasonable hours for North American subscribers.

What This Means for Replication

Pick two days. Send every week. Never stop. The specific days matter less than the ruthless consistency. Sean has demonstrated that a decade of showing up twice a week compounds into massive trust capital.


3. The Two-Email-Type Model

Every email Sean sends falls into one of two primary categories:

Type A: The Article/Content Email (Saturday)

  • Delivers the full article or a teaser linking to the full article + podcast
  • Includes 3 “binge-worthy” related podcasts as secondary content
  • Ends with a P.S. asking the reader to share with one person
  • No hard sell. The value IS the email.

Type B: The Article + Offer Email (Tuesday)

  • Same article delivery format
  • BUT the email is structured around a product that relates to the article topic
  • Soft launch: “Announcing [Product]”
  • Hard close 3 days later: “Last Day” email on Tuesday
  • The article always teaches something directly related to the product being sold

This pairing is clever: the Saturday article builds trust and creates desire around a topic, and the Tuesday follow-up monetises that desire with a relevant product.


4. Subject Line Formulas

The Data

PatternCount%
Contains “How To”61452.3%
Contains parenthetical ()56848.4%
Contains colon :59550.7%
Starts with “Why”12911.0%
Contains a number1059.0%
Contains a question mark736.2%
Average length68.4 chars

The Subject Line Architecture

Sean uses a consistent dual-benefit structure for the vast majority of subject lines:

[Main Benefit/Promise] ([Clarifier or Secondary Benefit])

Examples:

  • How To Create An Intensely Curious First Line For Your Article — no parenthetical needed, the title is self-contained
  • The Mick Jagger Moment: How To Transition from Task To Task (And Avoid Getting Distracted In The Switchover)
  • Why You Should Pay Attention To Giving (And Why Receiving Is Just As Important)
  • How To Not Be Stressed All The Time (And To Get In A State Of Play)
  • The “Pain Map Of Learning”: How Trainers Can Make Learning Fun Again

The parenthetical serves as a secondary hook — it answers the “so what?” or “but what specifically?” question that a prospect might have after reading the main title.

The “Announcing:” Signal

“Announcing:” appears in 393 subject lines (33.5% of all emails). It is Sean’s universal signal that a product or offer is involved. Subscribers learn over time that “Announcing” means something is being sold or launched. Rather than hiding this, he makes it transparent — which paradoxically builds trust.

Variations:

  • Announcing: — standard product launch
  • Announcing! — higher excitement, typically a new product
  • Announcement Special: — price-based special
  • Announcing Early Bird Offer— — pre-launch pricing
  • Presenting: — used for series/collections
  • Introducing: — brand new product

The Colon Structure

The colon is used to create a two-part revelation:

[Topic or Product Name]: [What You Will Learn or Get]

Examples:

  • Dartboard Pricing: How To Increase Prices Without Losing Clients
  • The Brain Audit: Why Clients Buy (And Why They Don’t)
  • Chaos Planning: How Disorganised People Can Also Get Things Done

This structure front-loads the product name (for brand recognition) while the second half sells the specific outcome.

Subject Line Formulas to Replicate

Formula 1 — The How-To Promise:

How To [Specific Result] (And [Secondary Result or Avoid Pain])

How To Build A List Systematically (And Get Clients To Buy From You Repeatedly)

Formula 2 — The Why Revelation:

Why [Counterintuitive Claim] (And [The Fix or Implication])

Why You Should Temporarily Ignore The “1000 True Fans” Concept (If You Want To Get Ahead)

Formula 3 — The Metaphor + Benefit:

The [Memorable Metaphor]: How To [Specific Result]

The Mick Jagger Moment: How To Transition from Task To Task

Formula 4 — Number + Specific Method:

[Number] [Specific Method] To [Desired Outcome] (And [Avoid Problem])

3 Ways To Motivate Yourself Again (And Restart What You Want To Do)

Formula 5 — The Announcement:

Announcing: [Product Name] — [Core Benefit/Promise]

Announcing: Dartboard Pricing — How To Increase Prices Without Losing Clients


5. The Article Email Blueprint

Every Sean D’Souza article email follows a remarkably consistent structural template, refined over a decade.

The Full Template

[ONE-SENTENCE CURIOSITY HOOK]

[Article Title — same as or similar to subject line]

[Link to read online / podcast]

[Note: "(This email contains the complete article. However, you can also...)" — 2024+]

[ARTICLE BODY]
  → Opening story or concrete scenario (real person, real situation)
  → Tension/problem introduced
  → Bridge to the reader's situation ("You and I..." / "Most of us...")
  → Named framework (Element 1, Element 2, Element 3)
  → Deep explanation with sub-stories for each element
  → Application and takeaway
  → Close with 1-sentence summary or memorable line

[SECONDARY CONTENT BLOCK]
"Three binge-worthy podcasts on [related topic]"
  1) [Title] — Read/Listen links
  2) [Title] — Read/Listen links
  3) [Title] — Read/Listen links

Warm regards
Sean [or Sean D'Souza]

P.S. [Share request — always asking reader to forward to one person]

[Social sharing links: Facebook / Twitter / LinkedIn]

Email Length

LengthCount%
Very short (<500 chars)998.4%
Short (500–2,000 chars)30425.9%
Medium (2,000–5,000 chars)45839.1%
Long (>5,000 chars)31226.6%
  • Average email: 4,533 characters (~750 words)
  • Median: 2,724 characters (~450 words)
  • The longer emails (>5,000 chars) contain the full article inline. The medium emails link out to the full version on the website/podcast.

Evolution: The Full Article In-Email Shift

A notable structural evolution occurs around 2023–2024: emails begin explicitly noting: “(This email contains the complete article. However, you can also read or listen to it at these links…)”

This represents a deliberate shift to deliver the full value inside the email itself, reducing reliance on click-through while still offering the podcast/website as alternative formats.


6. The Hook Architecture

The single most important copywriting technique in Sean’s emails is the one-sentence teaser that appears before the article title.

This line appears in virtually every email and serves as the subject-within-a-subject — a second hook after the subject line gets the email opened.

How It Works

The hook is typically:

  1. A counterintuitive statement
  2. A fragment that creates an incomplete thought (forces the reader to continue)
  3. A direct problem statement the reader is experiencing

Real Examples

“If you have no time all the time, you’re doing something wrong.”

“The problem is that we get stuck quickly but try to wriggle out just as rapidly. So what should we do?”

“We tend to look for super-glitzy concepts to improve our business, but in reality..”

“Usually, it’s an everyday event — with a slight twist. What is the slight twist?”

“We don’t often have success with scripts, because somehow we haven’t gotten the attention”

“Let’s find out what’s essential to consistently get us in this state of play.”

“It’s also the reason why you do extremely well in some areas, but fail miserably at others.”

Notice how many of these are incomplete sentences or sentences that end with a pivot (“but in reality…”, “because somehow…”). This is a deliberate open-loop technique — the brain seeks closure and keeps reading.

The Structural Pattern

Hook sentence (creates open loop)

Article Title

[rest of email]

This means every email has two hooks: the subject line (to get opened) and the teaser line (to get read past the title).


7. Story-First Copywriting System

Sean D’Souza’s most distinctive copywriting trait is that every article begins with a specific, concrete, named story — not a generic observation.

The Story Formula

[Specific person + specific context] + [specific problem or event] + [unexpected revelation] → Bridge to reader's situation

Real Article Openings

Example 1 — Celebrity story:

“It’s 1970, and TV host Dick Cavett has just asked his guest an unusual question. Cavett turns to the guest, singer/songwriter Paul Simon and starts by saying: ‘It’s possibly an impossible question.’ What Cavett is asking is ‘how does creativity happen?’ Referring to the super hit ‘Bridge Over Troubled Water’…”

Example 2 — Personal/wife story:

“My wife, Renuka, has always loved the rain. Not so much any more. It all came down to a single event. In the summer of 2023 we had been through almost seven months of nonstop rain…”

Example 3 — Client story:

“‘I want to earn $250,000 a year,’ said a client to me, ‘and I have a strategy to do so.’ Ever run into a situation where someone says something to you, and you’re not sure what to say next?”

Example 4 — Personal observation:

“When I moved to New Zealand from India, I didn’t know anyone. I wasn’t known for marketing — any references were solely for cartooning. If it seemed like the odds were stacked against us, well, they were.”

Example 5 — Historical/cultural reference:

“Back in the 1980s, a BBC program checked if myths lived up to scrutiny. One myth: Sweden’s high suicide rate. As it turned out, the myth was indeed a myth…”

Why This Works

The specificity of the story (a real TV show, a real conversation, a real year) creates instant credibility and engagement. Generic openings like “Have you ever wondered…” are forgettable. A story about Dick Cavett interviewing Paul Simon in 1970 is memorable and draws you in before you’ve even realised you’re being taught something.

Recurring story characters:

  • Renuka (Sean’s wife) — appears in dozens of articles, humanises his business and life
  • “A client” — client conversations serve as case studies and teaching moments
  • Historical figures — Mick Jagger, Paul Simon, Leonardo da Vinci, etc. used to illustrate universal principles
  • Sean himself — his own failures, experiments and discoveries are constantly referenced

8. The Promotional Email System

Anatomy of a Sean D’Souza Promotional Email

Promotional emails follow a tight structure:

Part 1: Problem Agitation (2–4 sentences) Start with a vivid description of the exact pain the reader is experiencing.

“You’ve seen it before. You’re about to get a customer to sign on the dotted line. And then they suddenly back away. What causes them to back away? What causes a sure sale to fall apart? When a sale falls apart, it’s extremely frustrating!”

Part 2: The Desire (1–3 sentences) Articulate what the reader actually wants — simply, without hype.

“Marketing provides thousands of ways to get and keep your customer’s attention. But you don’t want thousands of ways. You want a simple system that’s effective.”

Part 3: Social Proof Stacking Specific, numbered proof points. Note the use of precise numbers:

“A system that has been tested right across the planet… A system that has been tested for over 18 years and got results. A system that has over 967 testimonials. A system that has got results across all media…”

Part 4: Product Introduction + Explanation Name the product and explain what it does (not just what it is).

Part 5: The Bonus Goodie Almost every promotional sequence includes a time-limited bonus:

“When you buy The Brain Audit from 24 February to 28 February 2026 you’ll also get the bonus goodie ‘How To Identify The Right Target Audience For Your Business’.”

Part 6: Hard Deadline A specific date and time (not vague):

“(This offer expires on 28 February 2026)”

Part 7: P.S. Reinforcement

“P.S. Judge for yourself. You won’t regret it.”

The “Goodies” Strategy

A recurring pattern across virtually every promotional email is the inclusion of “goodies” — free bonus items that complement the core product. These are always:

  • Named specifically (e.g., “How To Identify The Right Target Audience For Your Business”)
  • Positioned as having stand-alone value
  • Tied to a deadline to create urgency without false scarcity

9. The Product Launch Cadence

The 2-Email Launch Sequence

Almost every product launch follows a Saturday + Tuesday pattern:

EmailDaySubject PatternPurpose
Email 1Saturday”Announcing: [Product] — [Benefit]“Introduce offer, low pressure
Email 2Tuesday”Last Day: [Product] + Special Bonus”Hard close, urgency, deadline

The window is typically 3–4 days. This is intentional — long enough to reach everyone, short enough to create genuine urgency.

Occasional 3-Email Sequences

For larger product launches (like Wonky Logic in early 2026), a 3-email sequence appears:

#DaySubject
1Tue Dec 16”Introducing: Wonky Logic” (Early Bird)
2Sat Dec 20”Announcing the launch of Wonky Logic”
3Sun Feb 1”Last Day! Introducing: Wonky Logic” (Deadline)

Pre-Launch Warming

Before a new product launch, Sean often sends content emails on the exact same topic. If he’s about to launch a Brain Audit promotion, the preceding Saturday email will be about marketing psychology or customer buying behaviour — seeding desire for the product before the ask arrives.


10. The Perpetual Sales Engine

The 10 Core Evergreen Products

Analysis of 484 promotional emails reveals Sean sells approximately 10 core products, recycled repeatedly throughout the year:

ProductPromo EmailsFrequency
Brain Audit / Why Customers Buy34~3x per year
Zing/Storytelling Course44~4x per year
5000bc Membership39~4x per year
Dartboard Pricing37~3x per year
Chaos Planning35~3x per year
Article Writing28~3x per year
Info Products Series23~2x per year
Pre-sell System22~2x per year
Uniqueness Series16~1.5x per year
Events / Workshops33~3x per year

The Significance of This

Rather than constantly creating new products, Sean has built a perpetual revenue machine by:

  1. Creating 8–10 excellent products once
  2. Running each one 3–4 times per year on rotation
  3. Always pairing the product with fresh free “goodies” to make each campaign feel new
  4. Slightly varying the subject lines and email copy while keeping the core message the same

This means a subscriber who joined in 2015 has seen the Brain Audit promoted approximately 30+ times over 11 years — without unsubscribing, because the content emails are valuable enough to maintain loyalty.


11. Content Recycling Strategy

The “From The Archives” Pattern

One of Sean’s most visible content reuse strategies is the archive email. These appear with a notation:

“(From the archives: One of the most read articles of 2016. To read this article online click on the cartoon)”

or more recently:

“(From the archives: One of the most read articles.)”

This does three things:

  1. Validates quality — “most read” is social proof that primes the reader to engage
  2. Reduces content production pressure — older articles can be re-promoted without apology
  3. Reaches new subscribers — someone who joined in 2023 hasn’t read the 2016 articles

Archive emails appear regularly from 2019 onwards, suggesting Sean consciously began systematising content reuse around that period.

Recurring Article Clusters

The same article topics recur across the full 11-year archive, often refreshed with new angles:

  • How to write a first line for an article (appears ~5 times across different years)
  • Why customers buy / brain audit concepts (appears ~8 times)
  • How to structure information products (appears ~4 times)
  • The importance of uniqueness in business (entire recurring series)
  • Time management / productivity systems (quarterly)

12. The P.S. Strategy

46.4% of all emails (544/1,173) contain a P.S. — making it one of the most consistent elements in Sean’s emails across 11 years.

What the P.S. Almost Always Says

In article emails, the P.S. almost universally asks for one specific action — sharing:

“P.S. Would you mind sharing this podcast with one person? I would love it. You can post the links in your WhatsApp Group, Facebook Groups, LinkedIn or even send an email.”

“P.S. Thank you for being a subscriber. If you’ve enjoyed listening to or reading this article, please consider sending it or recommending it to a few friends.”

“P.S. If you enjoyed the series, do share it with your friends.”

Why This Works

The P.S. ask has three properties that make it unusually effective:

  1. It asks for one person, not a broadcast. “Share with one person” is psychologically easy. “Tell your friends” is vague and ignored. One specific person is actionable.
  2. It provides the exact mechanism. “You can post the links in your WhatsApp Group, Facebook Groups, LinkedIn or even send an email” removes all friction.
  3. It comes after the value has been delivered. The reader has already consumed the article and is in a positive state when they encounter the ask.

In promotional emails, the P.S. reinforces the offer:

“P.S. Judge for yourself. You won’t regret it.”

Short, confident, no over-selling.


13. Multi-Platform Distribution

Every article email (from approximately 2019 onwards) offers the same content across multiple formats:

Read online [URL] | Apple Podcasts | Spotify | Google Podcast

This multi-format distribution reflects a deliberate content multiplication strategy:

  • Write the article once
  • Record it as a podcast episode
  • Send it as an email
  • Publish it on the website
  • Cross-promote via the email P.S.

The email functions as the distribution hub that connects all channels. Every touchpoint in the email ecosystem (website, podcast, email list) feeds the others.

The “Three Binge-Worthy Podcasts” Block

A signature structural element from approximately 2020 onwards:

“Three binge-worthy podcasts on [related topic]”

After delivering the main article, Sean always includes 3 related podcast episodes on the same broad theme (e.g., if the article is about article writing, the 3 bonus podcasts are also about writing).

This does two things:

  1. Keeps the subscriber in the Psychotactics content ecosystem for longer
  2. Builds topic authority — when you repeatedly see 3 related articles on the same subject, the sender appears to be the definitive expert on it

14. Recurring Content Themes

Analysis of 1,173 subject lines reveals Sean writes almost exclusively about 5 macro-themes:

Theme 1: Writing & Communication (est. 25% of content)

  • How to write articles, first lines, headlines
  • Copywriting formulas, sales page structure
  • Storytelling in marketing
  • How to explain concepts clearly

Theme 2: Marketing & Sales Psychology (est. 20%)

  • Why customers buy (and don’t buy)
  • Uniqueness and differentiation
  • Pricing psychology
  • Testimonials and social proof

Theme 3: Information Products & Courses (est. 20%)

  • How to create info-products
  • Structuring and naming products
  • Pre-selling techniques
  • Content sequencing

Theme 4: Productivity & Business Execution (est. 20%)

  • Time management, focus, energy management
  • How to avoid procrastination
  • Planning systems (Chaos Planning)
  • Learning and skill acquisition

Theme 5: Business Philosophy & Mindset (est. 15%)

  • Why passion matters (or doesn’t)
  • The ethics of giving and receiving
  • Long-term thinking vs. short-term tactics
  • Work as craft, not just commerce

This thematic consistency is not accidental. Sean writes about what his products solve, meaning every content email is implicitly pre-selling one of his courses or books — even when there is no explicit offer.


15. Relationship Building Patterns

Personalisation

Emails frequently open with “Hi Seree” — using the subscriber’s first name. This was more common in earlier years (2015–2020) and has diminished somewhat as email format shifted to inline articles.

The “Warm Regards” Signoff

Every single email closes with:

Warm regards
Sean

or

Warm regards
Sean D'Souza

Never “Best,” “Cheers,” or “Regards.” The word “Warm” is deliberate — it conveys human connection rather than professional distance.

Renuka as a Character

Sean’s wife Renuka appears frequently throughout the archive — in stories about rain anxiety, chocolate-giving to clients, travel stories, and business anecdotes. This recurring character makes Sean feel like a real person with a real life, not a marketing persona. Over 11 years, subscribers feel they know his family.

The New Zealand / World Traveller Identity

Sean consistently references his life in New Zealand, travels to Europe, workshops in Frankfurt and Athens, and encounters in Bali and Spain. This geographic specificity creates a vivid character and differentiates him from the US-centric marketing world.

Intellectual Curiosity as Brand

Sean regularly cites diverse sources: Dick Cavett, Paul Simon, Mick Jagger, Leonardo da Vinci, BBC documentaries, neuroscience research, personal watercolour workshops. This breadth of reference positions him as intellectually curious, not just a “marketing expert” — making him more interesting to read than most marketers.


16. The Copywriting Language Patterns

Sentence Length Pattern

Sean deliberately alternates between short punchy sentences and longer explanatory ones:

“Renuka no longer has anxiety about the rain. The pain that she felt has been minimised. Because the storms didn’t recur, it wasn’t an ongoing pain. Once that pain had enough time to heal, it disappeared. The excitement of a rainy day is back.”

Short. Short. Medium. Medium. Short. This rhythm is the prose equivalent of music — it creates momentum without fatigue.

The “You and I” Construction

Sean almost never writes “you” alone when making a universal point. He writes “you and I”:

“You and I need to know our energy black holes so that we can waste time effectively.” “You and I can’t do it all at once.” “Something similar happens when you and I initiate the learning process for our clients.”

This construction is psychologically inclusive — it removes the teacher/student distance and creates the feeling of a fellow traveller sharing an insight.

The “Let’s Find Out” Close

Articles frequently end their setup section with the phrase:

“Let’s find out.”

This phrase appears hundreds of times. It’s conversational, forward-moving, and collaborative — it invites the reader on a journey rather than telling them what to think.

Questions as Subheadings

Rather than “Part 1: The Problem,” Sean uses questions as structural markers:

“So what does a superpower look like?” “What is a precise result, you may ask?” “But how did ‘Puny Parker’ get his strength and agility?”

This keeps the reader in a receiving mode (questions activate curiosity) rather than a passive reading mode.

The Callback

Sean frequently opens with a story, teaches his lesson, then explicitly calls back to the opening story to close the loop. This creates narrative satisfaction and reinforces the teaching through repetition.

The “Notice” Technique

Sean regularly opens paragraphs with “Notice…”:

“Notice the slight tingling you feel?” “Have you noticed that ‘crazy car’ in traffic?”

This technique directs attention — telling the reader what to observe rather than asserting a fact.


17. The Business Model Behind the Emails

The Email List as the Revenue Engine

The entire Psychotactics business appears to run through the email list. There are no high-spend paid ads, no SEO-first content strategy, no social media dependence. The email list IS the business.

Revenue channels visible from the email archive:

ChannelHow It Appears in Emails
Info Products ($9.99–$50)Brain Audit, Chaos Planning, Dartboard Pricing, Wonky Logic
Course Bundles ($50–$200)Zing/Storytelling, Article Writing, Uniqueness Series
Membership (5000bc)~$100–$200/year, promoted quarterly
Live WorkshopsFrankfurt, Athens (2–6 people, premium pricing)
Free Goodies (lead magnets)Promote email signups and product discovery

The Flywheel

Content Email (Tue/Sat)

Subscriber trusts Sean and reads consistently

Content email teaches concept → creates desire for product that solves it

3 days later: "Announcing" email for relevant product

3 days later: "Last Day" email with bonus goodie

Sale. Product delivers value.

Subscriber trusts Sean MORE → reads more emails

(Repeat quarterly for 10 years)

The Patience Play

The most striking business insight from 11 years of emails is the patience. Products like The Brain Audit have been in the catalogue for over a decade. Rather than discontinuing them, Sean runs them 3 times per year forever. Each campaign brings in new buyers (new subscribers) and reactivates fence-sitters from previous campaigns.

Most marketers retire products after 2–3 years. Sean has demonstrated that the right product, marketed consistently with fresh framing, can generate revenue indefinitely.


18. Copywriting Templates You Can Steal

Template 1: The Article Email Subject Line

[Provocative or Counterintuitive Claim About [Topic]] ([Implied Question or Secondary Benefit])

Why You Should Temporarily Ignore The “1000 True Fans” Concept (If You Want To Get Ahead)


Template 2: The One-Sentence Email Hook

Write a single sentence that either:

  • States a counterintuitive truth: “If you have no time all the time, you’re doing something wrong.”
  • Ends in a deliberate fragment: “We tend to look for super-glitzy concepts to improve our business, but in reality…”
  • Poses a problem the reader is experiencing right now: “The problem is that we get stuck quickly but try to wriggle out just as rapidly.”

Template 3: The Story Opening Formula

[Specific person] + [Specific date/place/context] + [Specific event or quote] → [Tension/problem] → "Something similar happens when you and I [experience reader's situation]..."

Template 4: The 3-Element Framework Body

Here are [three/two/four] [adjective] [nouns] to [desired outcome]:

[Element 1: Named concept]
[2–4 sentences of explanation]
[Supporting story or example]

[Element 2: Named concept]
[2–4 sentences of explanation]
[Supporting story or example]

[Element 3: Named concept]
[2–4 sentences of explanation]

Summary: [Element 1] + [Element 2] + [Element 3]

Template 5: The Promotional Email Opening

[Vivid, specific 2-sentence description of the exact moment the reader feels the pain]

[What causes this / why it's frustrating]

[What you actually want] — not [complex thing], just [simple thing]:

You want [Specific simple desire].

Template 6: The Product Social Proof Stack

A system that has been tested [specific metric — years, countries, contexts].
A system that has [specific number] testimonials.
A system that works across [specific range of applications].
A system that [you can explain/use without needing to do something hard].

Template 7: The P.S. Share Ask

P.S. Would you mind sharing this [article/podcast] with one person?

I would love it. You can post the link in your WhatsApp Group, Facebook Groups, LinkedIn or even send an email.

Template 8: The “Binge-Worthy” Secondary Content Block

Three binge-worthy [articles/podcasts] on [topic]:

1) [Title] — Read / Listen / Watch
2) [Title] — Read / Listen / Watch
3) [Title] — Read / Listen / Watch

Template 9: The “Goodies” Bonus Structure

When you [buy/join] before [specific date], you also get [Goodie Name]:

This [book/report/guide] will give you an instant understanding of:
— [Specific point 1]
— [Specific point 2]
— [Specific point 3]

Template 10: The Announcement Subject Line for Launches

Announcing: [Product Name] — [Core Outcome Promise]
[Next email, 3 days later:]
Last Day: [Product Name] + [Bonus Goodie Name]

Summary: The 10 Principles Behind Sean D’Souza’s Email System

  1. Ruthless consistency — Tuesday and Saturday, every week, for a decade.
  2. Two types of emails only — content and promotional. Nothing else.
  3. Subject lines with dual hooks — main benefit + parenthetical clarifier.
  4. Stories before lessons — always a specific, named story before the teaching.
  5. “You and I” inclusivity — frame insights as shared discoveries, not lectures.
  6. Evergreen product rotation — 10 products promoted 3–4 times per year indefinitely.
  7. 3-day launch windows — Announce Saturday, close Tuesday.
  8. The “goodies” urgency mechanism — time-limited bonus instead of price discounts.
  9. One-sentence P.S. share ask — always ask to share with exactly one person.
  10. Content pre-sells products — every article teaches what your product solves.

Analysis based on 1,173 emails from Sean D’Souza (sean@psychotactics.com) spanning January 2015 to March 2026. Data extracted from Gmail archive.

← Back to Sean D'Souza